Neil2 (NM_201610) Mouse Recombinant Protein

CAT#: TP520912

Purified recombinant protein of Mouse nei like 2 (E. coli) (Neil2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR220912 representing NM_201610
Red=Cloning site Green=Tags(s)

MPEGPSVRKFHHLVSPFVGQKVVKTGGSSKKLHPAAFQSLWLQDAQVHGKKLFLRFDPDEEMEPLNSSPQ
PIQGMWQKEAVDRELALGPSAQEPSAGPSGSGEPVPSRSAETYNLGKIPSADAQRWLEVRFGLFGSIWVN
DFSRAKKANKKGDWRDPVPRLVLHFSGGGFLVFYNCQMSWSPPPVIEPTCDILSEKFHRGQALEALSQAQ
PVCYTLLDQRYFSGLGNIIKNEALYRARIHPLSLGSCLSSSSREALVDHVVEFSKDWLRDKFQGKERHTQ
IYQKEQCPSGHQVMKETFGPPDGLQRLTWWCPQCQPQLSSKGPQNLPSS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 36.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_963904
Locus ID 382913
UniProt ID Q6R2P8, Q1LZM6
Refseq Size 1914
Cytogenetics 14 D1
Refseq ORF 987
Synonyms Gm1212; NEH2
Summary Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Has DNA glycosylase activity towards 5-hydroxyuracil and other oxidized derivatives of cytosine with a preference for mismatched double-stranded DNA (DNA bubbles). Has low or no DNA glycosylase activity towards thymine glycol, 2-hydroxyadenine, hypoxanthine and 8-oxoguanine. Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...