Odf3 (NM_027019) Mouse Recombinant Protein
CAT#: TP520229
Purified recombinant protein of Mouse outer dense fiber of sperm tails 3 (Odf3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR220229 protein sequence
Red=Cloning site Green=Tags(s) MAEEVWMGTWRPHRPRGPIMALYSSPGPKYLIPPTTGFVKHTPTKLRAPAYSFRGAPMLLAENCSPGPRY SVNPKILKTGKDLGPAYSILGRYHTKTLLTPGPGDYFPEKSTKYVFDSAPSHSISARTKTFRVDSTPGPA AYMLPVVMGPHTVGKVSQPSFSIKGRSKLGSFSDDLHKTPGPAAYRQTEVQVTKFKAPQYTMAARVEPPG DKTLKPGPGAHSPEKVTLNKPCAPTVTFGIKHSDYMTPLVVDVE myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 27.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_081295 |
Locus ID | 69287 |
UniProt ID | Q920N1 |
Refseq Size | 924 |
Cytogenetics | 7 F4 |
Refseq ORF | 765 |
Synonyms | 1700011O04Rik; SHIPPO1 |
Summary | Outer dense fibers are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail. May help to maintain the passive elastic structures and elastic recoil of the sperm tail.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |