Rabgap1l (NM_001038621) Mouse Recombinant Protein

CAT#: TP520205

Purified recombinant protein of Mouse RAB GTPase activating protein 1-like (Rabgap1l), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CN¥ 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CN¥ 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR220205 representing NM_001038621
Red=Cloning site Green=Tags(s)

MEEGVPCPAPAAKLTPPVKKSQDMHDERSKLVNEYACRVLELLGMGHRLFVPRLLATSKEDLLQADFEGA
LKFFRVQLPKRYRAEENARRLMEQACNIKVPTKKLKKYEKEYQAMRENQLQQEDPMDRYKRENRRLQEAS
MRLEQENDDLAHELVTSKIALRNDLDQAEDKADVLNKELLFTKQRLVETEEEKRKQEEETAQLKEVFRKQ
LEKAEYEIKKTTAIIAEYKQICSQLSTRLEKQQAASKEELEAVKGKMMACKHCSDIFSKEGALKPVAVNR
EDQGLEADDEKDSLKKQLREMELELAQTKLQLVEAKCKIQELEHQRGALMNEIQAAKNSWFSKTLNSIKT
ATGTQPLQPPQAPQPPKEST

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 43.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001033710
Locus ID 29809
UniProt ID A6H6A9
Refseq Size 6338
Cytogenetics 1 H2.1
Refseq ORF 1110
Synonyms 5830411O09Rik; 8430421H08Rik; 9630005B12Rik; AW049894; Hh1; HHL; mKIAA0471
Summary GTP-hydrolysis activating protein (GAP) for small GTPase RAB22A, converting active RAB22A-GTP to the inactive form RAB22A-GDP (By similarity). Plays a role in endocytosis and intracellular protein transport. Recruited by ANK2 to phosphatidylinositol 3-phosphate (PI3P)-positive early endosomes, where it inactivates RAB22A, and promotes polarized trafficking to the leading edge of the migrating cells. Part of the ANK2/RABGAP1L complex which is required for the polarized recycling of fibronectin receptor ITGA5 ITGB1 to the plasma membrane that enables continuous directional cell migration (PubMed:27718357).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...