Slc51b (NM_178933) Mouse Recombinant Protein

CAT#: TP520007

Purified recombinant protein of Mouse solute carrier family 51, beta subunit (Slc51b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR220007 representing NM_178933
Red=Cloning site Green=Tags(s)

MDHSAEKAAANAEVPQELLEEMLWYFRAEDAAPWNYSILVLAVLVVMTSMFLLRRSILANRNRKKQPQDK
ETPEDLHLDDSIMKENNSQVFLRETLISEKPDLAPGEPELKEKDSSLVFLPDPQETES

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 15.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_849264
Locus ID 330962
UniProt ID Q80WK2
Refseq Size 488
Cytogenetics 9 C
Refseq ORF 384
Synonyms Ostb
Summary Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. Efficiently transports the major species of bile acids. Modulates SLC51A glycosylation, membrane trafficking and stability activities.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...