Slc51b (NM_178933) Mouse Recombinant Protein
CAT#: TP520007
Purified recombinant protein of Mouse solute carrier family 51, beta subunit (Slc51b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR220007 representing NM_178933
Red=Cloning site Green=Tags(s) MDHSAEKAAANAEVPQELLEEMLWYFRAEDAAPWNYSILVLAVLVVMTSMFLLRRSILANRNRKKQPQDK ETPEDLHLDDSIMKENNSQVFLRETLISEKPDLAPGEPELKEKDSSLVFLPDPQETES myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 15.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_849264 |
Locus ID | 330962 |
UniProt ID | Q80WK2 |
Refseq Size | 488 |
Cytogenetics | 9 C |
Refseq ORF | 384 |
Synonyms | Ostb |
Summary | Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. Efficiently transports the major species of bile acids. Modulates SLC51A glycosylation, membrane trafficking and stability activities.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |