Ptpa (NM_138748) Mouse Recombinant Protein

CAT#: TP519967

Purified recombinant protein of Mouse protein phosphatase 2 protein activator (Ptpa), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR219967 representing NM_138748
Red=Cloning site Green=Tags(s)

MAEGERQPPPDSSEETPPTTQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFDYKV
SEAIEKLVALLDTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDQEAENLVATVVPTHLAAAVPEVAVYLK
EAVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQVAIVFKVFDRYLEVMRKLQKTYRMEPAGSQGVW
GLDDFQFLPFIWGSSQLIDHPHLEPRHFVDEKAVSENHKDYMFLQCILFITEMKTGPFAEHSNQLWNISA
VPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 37.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_620087
Locus ID 110854
UniProt ID P58389
Refseq Size 2577
Cytogenetics 2 21.71 cM
Refseq ORF 969
Synonyms 2610042B21Rik; C77440; N28142; Ppp2r4; PR53
Summary PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Acts as a regulatory subunit for serine/threonine-protein phosphatase 2A (PP2A) modulating its activity or substrate specificity, probably by inducing a conformational change in the catalytic subunit, a proposed direct target of the PPIase. Can reactivate inactive phosphatase PP2A-phosphatase methylesterase complexes (PP2A(i)) in presence of ATP and Mg(2+). Reversibly stimulates the variable phosphotyrosyl phosphatase activity of PP2A core heterodimer PP2A(D) in presence of ATP and Mg(2+) (in vitro). The phosphotyrosyl phosphatase activity is dependent of an ATPase activity of the PP2A(D):PPP2R4 complex. Is involved in apoptosis; the function appears to be independent from PP2A (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...