Sco1 (NM_001040026) Mouse Recombinant Protein
CAT#: TP518719
Purified recombinant protein of Mouse SCO1 cytochrome c oxidase assembly protein (Sco1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR218719 representing NM_001040026
Red=Cloning site Green=Tags(s) MAALVRAAVVRSQCRQLWRLFPRGHGLRDVAERPRPEEACSCLRSRAFSAGPPPPGAGPEPKGGQAGSHR PKPGPVSWKSLALTFAIGGSLLAGMKYFKKEKIEKLEKQRHRSIGKPLLGGPFSLTTHNGEPKTDKDYLG QWVLIYFGFTHCPDICPEELEKMIEVVEEIDSIPSLPNLTPLFITIDPERDTKEAIATYVKEFSPKLVGL TGTKEEIDGVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKKKAEIAGSIAAHMRSH MKKR myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 31.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035115 |
Locus ID | 52892 |
UniProt ID | Q5SUC9 |
Refseq Size | 4280 |
Cytogenetics | 11 40.59 cM |
Refseq ORF | 852 |
Synonyms | 2610001C07Rik; D11Bwg1310e |
Summary | Copper metallochaperone essential for the maturation of cytochrome c oxidase subunit II (MT-CO2/COX2). Not required for the synthesis of MT-CO2/COX2 but plays a crucial role in stabilizing MT-CO2/COX2 during its subsequent maturation. Involved in transporting copper to the Cu(A) site on MT-CO2/COX2 (By similarity). Plays an important role in the regulation of copper homeostasis by controlling the abundance and cell membrane localization of copper transporter CTR1 (PubMed:25683716, PubMed:28973536).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |