Polr1c (NM_009085) Mouse Recombinant Protein

CAT#: TP517360

Purified recombinant protein of Mouse polymerase (RNA) I polypeptide C (Polr1c), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR217360 representing NM_009085
Red=Cloning site Green=Tags(s)

MAAAQAVEEMRTRVVLGEFGVRNVHTTDFPGNYAGYDDAWDQNRFEKNFRVDVVQMDEDTLEFDMVGIDA
AIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPILADPRLFEYRNQGEEEGTEIDTLQF
RLQVRCTRNPNAAKDSSDPNELYVNHKVYTRHMTWVPLGNQADVFPEGTIRPVHDDILIAQLRPGQEIDL
MMHCVKGIGKDHAKFSPVATASYRLLPAITLLEPVEGEAAEELSQCFSPGVIEVEEVQGKKVARVANARL
DTFSREIFRHEKLKKAVRLARVRDHYIFSVESTGVLPPDVLVSEAIKILMGKCRRFLDELDAVEMD

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 39.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_033111
Locus ID 20016
UniProt ID P52432
Refseq Size 1305
Cytogenetics 17 C
Refseq ORF 1038
Synonyms 40kDa; AA409007; AA959927; AL024089; Polr1e; RPA40; Rpo1-1
Summary DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...