Plscr3 (NM_001168497) Mouse Recombinant Protein

CAT#: TP516366

Purified recombinant protein of Mouse phospholipid scramblase 3 (Plscr3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR216366 representing NM_001168497
Red=Cloning site Green=Tags(s)

MAGYLPPKGYAPSPPPPYPVPSGYPEPVALHPGPGQAPVPTQVPAPAPGFALFPSPGPVAPGPPAPFVPL
PGVPPGLEFLVQIDQILIHQKAERVETFLGWETCNMYELRSGTGQQLGQAAEESNCCARLCCGARRPFRI
RLADPGDREVLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSILDADRQPVLRVVG
PCWTCGCGTDTNFEVKTKDESRSVGRISKQWGGLLREALTDADDFGLQFPVDLDVKVKAVLLGATFLIDY
MFFEKRGGAGPSAITS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 31.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001161969
Locus ID 70310
UniProt ID Q9JIZ9, Q5F283
Refseq Size 2861
Cytogenetics 11 42.9 cM
Refseq ORF 891
Synonyms 2210403O21Rik; 2610037N06Rik; ESTM3; X83310
Summary May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system. Seems to play a role in apoptosis, through translocation of cardiolipin from the inner to the outer mitochondrial membrane which promotes BID recruitment and enhances tBid-induced mitochondrial damages.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...