Paip1 (NM_145457) Mouse Recombinant Protein

CAT#: TP515919

Purified recombinant protein of Mouse polyadenylate binding protein-interacting protein 1 (Paip1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR215919 representing NM_145457
Red=Cloning site Green=Tags(s)

MSDSFDRAPEQTKPQRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLSANAPEFYPSGYSSNYTESYE
DGCEDYPTLSEYVQDFLNHLTEQPGSFETEIEQFAETLNGWVTTDDALQELVELIYQQATSIPNFSYMGA
RLCNYLSHHLTISPQSGNFRQLLLQRCRTEYEAKDQAAKGDEVTRKRFHAFVLFLGELYLNLEIKGTNGQ
VTRADILQVGLRELLNALFSNPMDDNLICAVKLLKLTGSVLEDTWKEKGKTDMEEIIQRIENVVLDANCS
RDVKQMLLKLVELRSSNWGRVHATSTYREATPENDPNYFMNEPTFYTSDGVPFTAADPDYQEKYQELLER
EDFFPDYEENGTDLSGAGDPYLDDIDDEMDPEIEEAYEKFCLESERKRKQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 46.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_663432
Locus ID 218693
UniProt ID Q8VE62
Refseq Size 4676
Cytogenetics 13 D2.3
Refseq ORF 1200
Synonyms PAIP-1
Summary Acts as a coactivator in the regulation of translation initiation of poly(A)-containing mRNAs. Its stimulatory activity on translation is mediated via its action on PABPC1. Competes with PAIP2 for binding to PABPC1. Its association with EIF4A and PABPC1 may potentiate contacts between mRNA termini. May also be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...