Sptssb (NM_001164210) Mouse Recombinant Protein
CAT#: TP515871
Purified recombinant protein of Mouse serine palmitoyltransferase, small subunit B (Sptssb), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR215871 representing NM_001164210
Red=Cloning site Green=Tags(s) MDFKRVKEYFAWLYYQYQIITCCAVMEPWEQSMLNTIILTIVAMVVYTAYVFIPIHIRLAWEFFSKICGY DSSISN myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 9.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001157682 |
Locus ID | 66183 |
UniProt ID | Q925E8 |
Refseq Size | 1786 |
Cytogenetics | 3 E2 |
Refseq ORF | 228 |
Synonyms | 1110032A04Rik; ADMP; Sssptb |
Summary | Stimulates the activity of serine palmitoyltransferase (SPT). The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference, complexes with this subunit showing a clear preference for longer acyl-CoAs. The SPTLC1-SPTLC2-SPTSSB complex shows a strong preference for C18-CoA substrate, while the SPTLC1-SPTLC3-SPTSSB isozyme displays an ability to use a broader range of acyl-CoAs, without apparent preference.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |