Crtc1 (NM_001004062) Mouse Recombinant Protein

CAT#: TP509600

Purified recombinant protein of Mouse CREB regulated transcription coactivator 1 (Crtc1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR209600 protein sequence
Red=Cloning site Green=Tags(s)

MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQYYGGSLPNVNQ
IGSSSVDLAFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHGRQADSCPYGTVYLSP
PADTSWRRTNSDSALHQSTMTPSQAESFTGGSQDAHQKRVLLLTVPGMEDTGAETDKTLSKQSWDSKKAG
SRPKSCEVPGINIFPSADQENTTALIPATHNTGGSLPDLTNIHFPSPLPTPLDPEEPPFPALTSSSSTGS
LAHLGVGGAGQGMNTPSSSPQHRPAVVSPLSLSTEARRQQAQQVSPTLSPLSPITQAVAMDALSLEQQLP
YAFFTQTGSQQPPPQPQPPPPPPPVSQQQPPPPQVSVGLPQGGPLLPSASLTRGPQLPPLSVTVPSTLPQ
SPTENPGQSPMGIDATSAPALQYRTSAGSPATQSPTSPVSNQGFSPGSSPQHTSTLGSVFGDAYYEQQMT
ARQANALSRQLEQFNMMENAISSSSLYNPGSTLNYSQAAMMGLSGSHGGLQDPQQLGYTGHGGIPNIILT
VTGESPPSLSKELSSTLAGVSDVSFDSDHQFPLDELKIDPLTLDGLHMLNDPDMVLADPATEDTFRMDRL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 66.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001004062
Locus ID 382056
UniProt ID Q68ED7
Refseq Size 5674
Cytogenetics 8 B3.3
Refseq ORF 1893
Synonyms AI413414; Mect1; mKIAA0616; R74955; TORC1
Summary Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites (PubMed:29211348). Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated (PubMed:29211348). Acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 with TAF4. Regulates the expression of specific CREB-activated genes such as the steroidogenic gene, StAR. Potent coactivator of PGC1alpha and inducer of mitochondrial biogenesis in muscle cells (By similarity). In the hippocampus, involved in late-phase long-term potentiation (L-LTP) maintenance at the Schaffer collateral-CA1 synapses. May be required for dendritic growth of developing cortical neurons. In concert with SIK1, regulates the light-induced entrainment of the circadian clock. In response to light stimulus, coactivates the CREB-mediated transcription of PER1 which plays an important role in the photic entrainment of the circadian clock.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...