Grhl3 (NM_001013756) Mouse Recombinant Protein

CAT#: TP509332

Purified recombinant protein of Mouse grainyhead like transcription factor 3 (Grhl3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR209332 protein sequence
Red=Cloning site Green=Tags(s)

MSNELDFRSVRLLKNDPVSFQKFPYSNEDEAWKTYLENPLTAATKAMMRVNGDEESVAALSFLYDYYMGP
KEKRILSSSTGGRNDQGKKFYHSMDYEPDLAPLESPTHLMKFLTENVSGSPDYTDQLKKNNLLGLEGVLP
TPGKTNTVPPGPSKLEASSMDSYLLPASDIYDNGSLNSLFESIHGVPPTQRWQPDSTFKDDPQESLLFPD
ILKTSPDPPCPEDYPGLKSDFEYTLGSPKAIHIKAGESPMAYLNKGQFYPVTLRTPAGGKGLALSSSKVK
SVVMVVFDNDKVPVEQLRFWRHWHSRQPTAKQRVIDVADCKENFNTVQHIEEVAYNALSFVWNVNEEAKV
FIGVNCLSTDFSSQKGVKGVPLNLQIDTYDCGAGTERLVHRAVCQIKIFCDKGAERKMRDDERKQFRRKV
KCPDSSNNAGIKGCLLSGFRGNETTYLRPETDLETQPVLFIPNLHFSSLQRPGGVVPSAGHSSSDRLPLK
RTCSPFAEEFEPLPSKQAKEDDLQRVLLYVRRETEEVFDALMLKTPDLKGLRNAISEKYGLPEENICKVY
KKCKRGILVNMDNNIIQHYSNHVAFLLDMGELDGKIQIILKEL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 67.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001013778
Locus ID 230824
UniProt ID Q5FWH3
Refseq Size 2798
Cytogenetics 4 67.76 cM
Refseq ORF 1812
Synonyms AI561912; ct; Get1; Som; Tfcp2l4
Summary Transcription factor playing important roles in primary neurulation and in the differentiation of stratified epithelia of both ectodermal and endodermal origin. Binds directly to the consensus DNA sequence 5'-AACCGGTT-3' acting as an activator and repressor on distinct target genes. Essential for epidermal differentiation and barrier formation at the end of embryogenesis with TGM3 as critical direct target (PubMed:21081122, PubMed:20654612, PubMed:25347468). Exhibits functional redundancy with GRHL2 in epidermal morphogenetic events such as eyelid fusion and epidermal wound repair (PubMed:21081122). Despite being dispensable during normal epidermal homeostasis in the adulthood, is again required for barrier repair after immune-mediated epidermal damage, regulates distinct gene batteries in embryonic epidermal differentiation and adult epidermal barrier reformation after injury (PubMed:25347468). Plays unique and cooperative roles with GRHL2 in establishing distinct zones of primary neurulation. Essential for spinal closure, functions cooperatively with GRHL2 in closure 2 (forebrain/midbrain boundary) and posterior neuropore closure (PubMed:14608380, PubMed:20654612). Also required for proper development of the oral periderm (PubMed:24360809). No genetic interaction with GRHL1, no functional cooperativity due to diverse target gene selectivity (PubMed:21081122).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...