Mtmr9 (NM_177594) Mouse Recombinant Protein

CAT#: TP508680

Purified recombinant protein of Mouse myotubularin related protein 9 (Mtmr9), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR208680 representing NM_177594
Red=Cloning site Green=Tags(s)

MEFAELIKTPRVDNVVLHRPFYTAVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDAIDKRFVGSLGTII
IKCKDFRIIQLDIPGMEECLNIASSIEALSTLDSVTLMYPFFYRPMFEVIEDGWHSFLPEQEFEFYSSAT
SEWRLSYINKDFSICPSYPPTVIVPKSVDDEALRKVAAFRHGGRFPVLSYYHKKNGMVIMRSGQPLTGTN
GRRCKEDEKLINATLRAGKRGYLIDTRSLNVAQQARAKGGGFEQEAHYPQWRRIHKSIERYHVLQESLIK
LVEACNEQTHNMDRWLGKLEASNWLTHIKEILTTACLAAQCIDREGASVLIHGTEGTDSTLQVTSLAQII
LEPRSRTIRGFEALIEREWLQAGHPFQQRCAQSAYCSSKQKWEAPVFLLFLDCVWQILRQFPCSFEFNEH
FLIMLFEHAYASQFGTFLGNNESERCKLKLQQKTMSLWSWVNRPGELSKFTNPLFEANNLVIWPSVAPQS
LQLWEGIFLRWSRSSKYLDEAYEEMVNIIEYNKELQAKVNVLRRQLAELETEDGL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 63.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_808262
Locus ID 210376
UniProt ID Q9Z2D0
Refseq Size 2457
Cytogenetics 14 D1
Refseq ORF 1635
Synonyms 9430075G12Rik; AA516943; AF073881; LIP-STYX; mMTMH3; MTMR8
Summary Acts as an adapter for myotubularin-related phosphatases (PubMed:12890864). Increases lipid phosphatase MTMR6 catalytic activity, specifically towards phosphatidylinositol 3,5-bisphosphate, and MTMR6 binding affinity for phosphorylated phosphatidylinositols (By similarity). Positively regulates lipid phosphatase MTMR7 catalytic activity (PubMed:12890864). The formation of the MTMR6-MTMR9 complex, stabilizes both MTMR6 and MTMR9 protein levels (By similarity). Plays a role in the late stages of macropinocytosis possibly by regulating MTMR6-mediated dephosphorylation of phosphatidylinositol 3-phosphate in membrane ruffles (By similarity). Negatively regulates DNA damage-induced apoptosis, in part via its association with MTMR6 (By similarity). Does not bind mono-, di- and tri-phosphorylated phosphatidylinositols, phosphatidic acid and phosphatidylserine (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...