Atp6v1b1 (NM_134157) Mouse Recombinant Protein

CAT#: TP508239

Purified recombinant protein of Mouse ATPase, H+ transporting, lysosomal V1 subunit B1 (Atp6v1b1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (3)
Atp6v1b1 Antibody - N-terminal region
    • 50 ug

CNY 4,628.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR208239 protein sequence
Red=Cloning site Green=Tags(s)

MATTVDSRSSGFTGNSCDPGTAQEHVQAVTRNYITHPRVTYRTVCSVNGPLVVLDQVKFAQYAEIVNFTL
PDGTQRSGQVLEVAGTKAIVQVFEGTSGIDSQKTTCEFTGDILRTPVSEDMLGRIFNGSGKPIDKGPAVM
AEEFLDINGQPINPHDRIYPEEMIQTGISPIDVMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKS
KAVLDYHEDNFAIVFAAMGVNMETARFFKSDFEQNGTMGNVCLFLNLANDPTIERIITPRLALTTAEFLA
YQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRGGSITQIPILTM
PNDDITHPIPDLTGFITEGQIYVDRQLHNRQVYPPINVLPSLSRLMKSAIGEGMTRKDHGDVSNQLYACY
AIGKDVQAMKAVVGEEALTSEDLLYLEFLQKFEKNFITQGPYENRTVFESLDLGWKLLRIFPKEMLKRIP
QSMTDEFYSRQGAQQDPASDTAL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 57.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_598918
Locus ID 110935
UniProt ID Q91YH6
Refseq Size 1945
Cytogenetics 6 35.94 cM
Refseq ORF 1542
Synonyms Atp6b1; AW208839; D630003L15; D630030L16Rik; D630039P21Rik; Vpp-3; Vpp3
Summary Non-catalytic subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons (PubMed:16174750, PubMed:23028982). V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment (By similarity). Essential for the proper assembly and activity of V-ATPase (By similarity). In renal intercalated cells, mediates secretion of protons (H+) into the urine thereby ensuring correct urinary acidification (PubMed:16174750). Required for optimal olfactory function by mediating the acidification of the nasal olfactory epithelium (PubMed:23028982).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...