Pltp (NM_011125) Mouse Recombinant Protein

CAT#: TP507917

Purified recombinant protein of Mouse phospholipid transfer protein (Pltp), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR207917 protein sequence
Red=Cloning site Green=Tags(s)

MVLLWALFLALLAGAHAELPGCKIRVTSAALELVKQEGLRFLEQELETITIPDVYGAKGHFYYNISDVRV
TQLHLISSELHFQPDQDLLLNISNASLGLHFRRQLLYWFLYDGGYINASAEGVSIRTGLQLSQDSSGRIK
VSNVSCEASVSKMNMAFGGTFRRMYNFFSTFITSGMRFLLNQQICPVLYHAGTVLLNSLLDTVPVRSSVD
DLVGIDYSLLKDPVVSNGNLDMEFRGAFFPLKEDNWSLPNRAVEPQLEDDERMVYVAFSEFFFDSAMESY
FQAGALQLTLVGDKVPSDLDMLLRATYFGSIVLLSPTVINSPLKLKLEATSPPRCTIKPSGTTISITASV
TITLAPPMLPEVELSKMIMEGRLSAKLTLRGKALRVKLDLRRFQIYSNQSALESLALIPLQAPLKTLLQI
GVMPLLNERTWRGVQIPLPEGINFVREVVTNHAGFVTVGADLHFAKGLREVIDKNRPADVAASHVPPPSA
AAA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 54.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_035255
Locus ID 18830
UniProt ID P55065
Refseq Size 1806
Cytogenetics 2 85.27 cM
Refseq ORF 1482
Synonyms Bpife; OD107
Summary Facilitates the transfer of a spectrum of different lipid molecules, including diacylglycerol, phosphatidic acid, sphingomyelin, phosphatidylcholine, phosphatidylglycerol, cerebroside and phosphatidyl ethanolamine. Essential for the transfer of excess surface lipids from triglyceride-rich lipoproteins to HDL, thereby facilitating the formation of smaller lipoprotein remnants, contributing to the formation of LDL, and assisting in the maturation of HDL particles. PLTP also plays a key role in the uptake of cholesterol from peripheral cells and tissues that is subsequently transported to the liver for degradation and excretion. Two distinct forms of PLTP exist in plasma: an active form that can transfer PC from phospholipid vesicles to high-density lipoproteins (HDL), and an inactive form that lacks this capability (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...