Asz1 (NM_023729) Mouse Recombinant Protein

CAT#: TP507612

Purified recombinant protein of Mouse ankyrin repeat, SAM and basic leucine zipper domain containing 1 (Asz1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR207612 protein sequence
Red=Cloning site Green=Tags(s)

MAAGTLRGLAVAGGGESSDSEDDGWDIGYLDRSSQKLKRSLPVEEKNETFKKALTTGDISLVKELLDSGI
NVDSSFRYGWTPLMYAASVANAELVRFLLDRGANASFDKDKLTILISACSARGSEEQVLKCVELLLSRNA
DPNTACRRLMTPIMYAARDGHTQVVALLVAHGAEVNAQDENGYTALTWAARQGHKNVILKLLELGANKML
QTKDGRTPSEIAKRNKHLEIFNFLSLTLNPLEGKLQQLAKEETICKLLATDSDKEKDHIFSPYTAFGDLE
IFLHGLGLEHMTDSLKEKDITLRHLLTMKKDELTKNGIASKDQQKILAALKELEVEEINFGKLPEVTKLE
ISGDEFLNFLLKLNKQCGHLITAVQNIITELPVNSHKIVLEWASPRNFTSVCEELVSNVEDLNEEVCRLK
ELIQKMQNERENDPTHIPLVEEVSTWKTRILKRSAVTVCGFGLLLFIGKLTLQRK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 53 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_076218
Locus ID 74068
UniProt ID Q8VD46
Refseq Size 1740
Cytogenetics 6 A2
Refseq ORF 1428
Synonyms 4933400N19Rik; Gasz; ORF3
Summary Plays a central role during spermatogenesis by repressing transposable elements and preventing their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposons. Its association with pi-bodies suggests a participation in the primary piRNAs metabolic process. Required prior to the pachytene stage to facilitate the production of multiple types of piRNAs, including those associated with repeats involved in regulation of retrotransposons. May act by mediating protein-protein interactions during germ cell maturation.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...