Rufy3 (NM_027530) Mouse Recombinant Protein
CAT#: TP507512
Purified recombinant protein of Mouse RUN and FYVE domain containing 3 (Rufy3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR207512 protein sequence
Red=Cloning site Green=Tags(s) MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHEDPNYLMANERM NLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLV PEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAG LLVGLNVIDANFCIKGEDLDSQVGVIDFSMYLKDGNSSKGSEGDGQITAILDQKNYVEELNRHLNATVNN LQTKVDLLEKSNTKLTEELAVANNRIITLQEEMERVKEESSYLLESNRKGPKQDRTAEGQALSEARKHLK EETQLRLDVEKELELQISMRQEMELAMKMLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVK QKSELNSRLEEKTNQMAATIKQLEQSEKDLVKQAKTLNSAANKLIPKHH myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 53.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_081806 |
Locus ID | 52822 |
UniProt ID | Q9D394 |
Refseq Size | 4097 |
Cytogenetics | 5 43.77 cM |
Refseq ORF | 1410 |
Synonyms | 2810428M05Rik; 6330416M07Rik; AW455998; AW538594; D5Bwg0860e; Ripx; Rpipx |
Summary | Plays a role in the generation of neuronal polarity formation and axon growth (PubMed:24720729). Implicated in the formation of a single axon by developing neurons (PubMed:24720729). May inhibit the formation of additional axons by inhibition of PI3K in minor neuronal processes (By similarity). Plays a role in the formation of F-actin-enriched protrusive structures at the cell periphery (By similarity). Plays a role in cytoskeletal organization by regulating the subcellular localization of FSCN1 and DBN1 at axonal growth cones (PubMed:24720729). Promotes gastric cancer cell migration and invasion in a PAK1-dependent manner (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |