Rab3ip (NM_001003950) Mouse Recombinant Protein

CAT#: TP506828

Purified recombinant protein of Mouse RAB3A interacting protein (Rab3ip), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206828 protein sequence
Red=Cloning site Green=Tags(s)

MANDPLEGFHEVNLASPTSPDLLGVCDPGTQEQTTSPSVIYRPHPSTLCAAPLQANALDLSDLPTQPVYS
SPRHFNCAEVSNISAHAPDPASSVPSAVASGLTKLTSRKDSCNAEREFLQGATITEASAGNDDIFGLSTD
SLSRLRSPSVLEVREKGYERLKEELAKAQREAHKMVREANVKQATAEKQLKEAQGKIDVLQAEVAALKTL
VLSSSPTSPTQEPLAAAKTPFKRGHTRNKSTSSAMGGSHQDLSVIQPIVKDCKEADLSLYNEFRSWKDEP
TMDRTCPFLDKIYQEDIFPCLTFAKSELASAVLEAVENNTLSIEPVGLQPIRFVKASAVECGGPKKCALT
GQSKPCRHRIRLGDSSCCYYISPFCRYRITSVCNFFTYIRYIQQGLVKQQDVDQMFWEVMQLRKEMSLAK
LGYFKEEL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 47.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001003950
Locus ID 216363
UniProt ID Q68EF0, Q8BR32
Refseq Size 2690
Cytogenetics 10 64.96 cM
Refseq ORF 1287
Synonyms B230311A06; Gtpat12; Rabin3
Summary Guanine nucleotide exchange factor (GEF) which may activate RAB8A and RAB8B. Promotes the exchange of GDP to GTP, converting inactive GDP-bound Rab proteins into their active GTP-bound form. Mediates the release of GDP from RAB8A and RAB8B but not from RAB3A or RAB5. Modulates actin organization and promotes polarized transport of RAB8A-specific vesicles to the cell surface. Together with RAB11A, RAB8A, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...