Cpa1 (NM_025350) Mouse Recombinant Protein

CAT#: TP506658

Purified recombinant protein of Mouse carboxypeptidase A1, pancreatic (Cpa1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206658 representing NM_025350
Red=Cloning site Green=Tags(s)

MKRLLVLSVLLAAVFGNENFVGHQVLRISATDEAQVQKVRELEELEHLKLDFWRDPARAGLPIDVRVPFP
TIQSVKAFLEYHDISYEIMIEDVQSLLDEEKQQMSAFQARALSTDAFNYATYHTLDEIYEFMDLLVTEHP
QLVSKIQIGSTFEGRPINVLKFSTGGTNRPAIWIDTGIHSREWVTQASGVWFAKKITKDYGQEPTLTAIL
DNMDIFLEIVTNPDGFVYTHKTNRMWRKTRSHTEGSLCVGVDPNRNWDAAFGMPGASSNPCSETYRGKFP
NSEVEVKSIVDFVTSHGNIKAFISIHSYSQLLLYPYGYTSEPAPDKEELDQLAKSAVTALTSLHGTKFKY
GSIIDTIYQASGSTIDWTYSQGIKYSFTFELRDTGLRGFLLPASQIIPTAEETWLALLTIMDHTVKHPY

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 47.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_079626
Locus ID 109697
UniProt ID Q7TPZ8
Refseq Size 1578
Cytogenetics 6 12.52 cM
Refseq ORF 1257
Synonyms 0910001L12Rik; Cpa
Summary This gene encodes carboxypeptidase A, a zinc-dependent metalloprotease that cleaves peptide bonds at the C-terminus of protein substrates. The encoded preproprotein undergoes proteolytic activation to generate a mature, functional enzyme. This gene is expressed in pancreas, the encoded protein is a major component of digestive enzymes secreted by pancreas and plays an important role in the process of digestion. This gene is located in a cluster of related carboxypeptidase genes on chromosome 6. [provided by RefSeq, Jan 2016]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...