Ndrg1 (NM_008681) Mouse Recombinant Protein
CAT#: TP505950
Purified recombinant protein of Mouse N-myc downstream regulated gene 1 (Ndrg1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205950 protein sequence
Red=Cloning site Green=Tags(s) MSRELHDVDLAEVKPLVEKGESITGLLQEFDVQEQDIETLHGSLHVTLCGTPKGNRPVILTYHDIGMNHK TCYNPLFNSEDMQEITQHFAVCHVDAPGQQDGAPSFPVGYMYPSMDQLAEMLPGVLHQFGLKSVIGMGTG AGAYILTRFALNNPEMVEGLVLMNVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEIHNNVEVVHT YRQHILNDMNPSNLHLFISAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDNSPAVDAVVECNSKLDPTK TTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLEGTRSRSHTSEGP RSRSHTSEGSRSRSHTSEDARLNITPNSGATGNNAGPKSMEVSC myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 43 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_032707 |
Locus ID | 17988 |
UniProt ID | Q62433 |
Refseq Size | 2909 |
Cytogenetics | 15 D2 |
Refseq ORF | 1185 |
Synonyms | CAP43; CMT4D; DRG1; HMSNL; Ndr1; Ndrl; NMSL; PROXY1; RTP; TDD5 |
Summary | Stress-responsive protein involved in hormone responses, cell growth, and differentiation. Acts as a tumor suppressor in many cell types. Necessary but not sufficient for p53/TP53-mediated caspase activation and apoptosis. Required for vesicular recycling of CDH1 and TF. May also function in lipid trafficking. Protects cells from spindle disruption damage. Functions in p53/TP53-dependent mitotic spindle checkpoint. Regulates microtubule dynamics and maintains euploidy (By similarity). Has a role in cell trafficking notably of the Schwann cell and is necessary for the maintenance and development of the peripheral nerve myelin sheath.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |