Trib1 (NM_144549) Mouse Recombinant Protein

CAT#: TP505755

Purified recombinant protein of Mouse tribbles pseudokinase 1 (Trib1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (3)
Goat Anti-Trib1 (mouse) (aa304-317) Antibody
    • 100 ug

CNY 5,371.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205755 protein sequence
Red=Cloning site Green=Tags(s)

MRVGPVRFALSGASQPRGPGLLFPAARGTPAKRLLDTDDAGAVAAKCPRLSECSSPPDYLSPPGSPCSPQ
PPPSTQGTGGSCVSSPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCKEFPIKHYQDKIRPYIQLPSH
SNITGIVEVLLGESKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSAIVLGDLKLRK
FVFSTEERTQLRLESLEDTHIIKGEDDALSDKHGCPAYVSPEILNTTGTYSGKAADVWSLGVMLYTLLVG
RYPFHDSDPSALFSKIRRGQFCIPEHVSPKARCLIRSLLRREPSERLTAPQILLHPWFEYVLEPGYVDSE
IGTSDQIVPEYQEDSDISSFFC

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 41.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_653132
Locus ID 211770
UniProt ID Q8K4K4
Refseq Size 4026
Cytogenetics 15 D1
Refseq ORF 1119
Synonyms A530090O15Rik; TRB-1; Trb1
Summary Adapter protein involved in protein degradation by interacting with COP1 ubiquitin ligase (PubMed:23515163, PubMed:20410507). Promotes CEBPA degradation and inhibits its function (PubMed:20410507). Controls macrophage, eosinophil and neutrophil differentiation via the COP1-binding domain (PubMed:24003916, PubMed:23515163). Regulates myeloid cell differentiation by altering the expression of CEBPA in a COP1-dependent manner (PubMed:23515163). Interacts with MAPK kinases and regulates activation of MAP kinases, but has no kinase activity (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...