Prkx (NM_016979) Mouse Recombinant Protein

CAT#: TP505408

Purified recombinant protein of Mouse protein kinase, X-linked (Prkx), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205408 protein sequence
Red=Cloning site Green=Tags(s)

MEPPAGAAATVKDPDHDPVKTKVSAPAADPKPRTSSQKAGHSLQDWDTIATVGTGTFGRVNLVKEKTGRQ
YCALKIMSIPDVIRLKQEQHVQNEKAVLKEINHPFLIKLLWTGHDNRFLYMLMEFVPGGELFTYLRNRGR
FSSVASVFYATEIVCAIEYLHSKEIVYRDLKPENILLDREGHIKLTDFGFAKKLVDRTWTLCGTPEYLAP
EVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILACKIDFPRQLDFTSKDLIKKLLVVDR
TRRLGNMKNGAEDIKRHRWFRGVEWESVPQRKLKPPIVPKLSGDGDISNFETYPESELDKTPSVSDKDLE
TFKNF

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 40.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_058675
Locus ID 19108
UniProt ID Q922R0
Refseq Size 3217
Cytogenetics X B
Refseq ORF 1068
Synonyms Pkare; PKX1
Summary Serine/threonine protein kinase regulated by and mediating cAMP signaling in cells. Acts through phosphorylation of downstream targets that may include CREB, SMAD6 and PKD1 and has multiple functions in cellular differentiation and epithelial morphogenesis. Regulates myeloid cell differentiation through SMAD6 phosphorylation. Involved in nephrogenesis by stimulating renal epithelial cell migration and tubulogenesis. Also involved in angiogenesis through stimulation of endothelial cell proliferation, migration and vascular-like structure formation.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...