Atp6v0d1 (NM_013477) Mouse Recombinant Protein
CAT#: TP505337
Purified recombinant protein of Mouse ATPase, H+ transporting, lysosomal V0 subunit D1 (Atp6v0d1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205337 protein sequence
Red=Cloning site Green=Tags(s) MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLYLQSTDYGNFLANEASPLTVSVI DDKLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAEPVPKCHPLGSFEQMEA VNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCP ILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEG AGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPI F myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 40.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_038505 |
Locus ID | 11972 |
UniProt ID | P51863 |
Refseq Size | 1617 |
Cytogenetics | 8 D3 |
Refseq ORF | 1056 |
Synonyms | Ac39; AI267038; Atp6d; P39; VATX; Vma6 |
Summary | Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. May play a role in coupling of proton transport and ATP hydrolysis. May play a role in cilium biogenesis through regulation of the transport and the localization of proteins to the cilium (By similarity). In aerobic conditions, involved in intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Atp6v0d1产品