Ciao1 (NM_025296) Mouse Recombinant Protein
CAT#: TP505061
Purified recombinant protein of Mouse cytosolic iron-sulfur protein assembly 1 (Ciao1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205061 protein sequence
Red=Cloning site Green=Tags(s) MKDSLVLQSRVPAHPDSRCWFLAWNPSGTLLASCGGDRKIRIWGTEGDSWICKSVLSEGHQRTVRKVAWS PCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEY ECVSVLSSHTQDVKHVVWHPSQELLASASYDDTVKLYQEEGDDWVCCATLEGHESTVWSIAFDPSGQRLA SCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHTRTIYDVAWCQLTGALATACGDDAIRVFE EDPGSDPQQPTFSLTAHLRQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWEYHQPAGL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 37.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079572 |
Locus ID | 26371 |
UniProt ID | Q99KN2 |
Refseq Size | 3075 |
Cytogenetics | 2 61.86 cM |
Refseq ORF | 1020 |
Synonyms | AW210570; Wdr39 |
Summary | Key component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into extramitochondrial Fe/S proteins (By similarity). As a CIA complex component, interacts specifically with CIAO2A or CIAO2B and MMS19 to assist different branches of iron-sulfur protein assembly, depending of its interactors. The complex CIAO1:CIAO2B:MMS19 binds to and facilitates the assembly of most cytosolic-nuclear Fe/S proteins. CIAO1:CIAO2A specifically matures ACO1 and stabilizes IREB2 (By similarity). Seems to specifically modulate the transactivation activity of WT1. As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |