Ciao1 Rabbit Polyclonal Antibody
CAT#: TA343486
Rabbit Polyclonal Anti-Ciao1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 7,106.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Ciao1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ciao1. Synthetic peptide located within the following region: MKDSLVLQSRVPAHPDSRCWFLAWNPSGTLLASCGGDRKIRIWGTEGDSW |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 38 kDa |
Gene Name | cytosolic iron-sulfur protein assembly 1 |
Database Link | |
Background | Ciao1 is an essential component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. It is required for the maturation of extramitochondrial Fe/S proteins. Seems to specifically modulate the transactivation activity of WT1. As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation. |
Synonyms | CIA1; WDR39 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Zebrafish: 86%; Pig: 79%; Bovine: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |