Mgme1 (NM_028984) Mouse Recombinant Protein

CAT#: TP505034

Purified recombinant protein of Mouse mitochondrial genome maintenance exonuclease 1 (Mgme1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CN¥ 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CN¥ 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205034 representing NM_028984
Red=Cloning site Green=Tags(s)

MKLPLTFCRLLSRLNRFSVKASPPVSFSTFSYLCSQKKKNSYEAVDQAKYSRLVRSVLSRGPAQTPESLF
KEDDVLYGPVSKHKAAEPEPQARVPQHCFPIFNEERTGKPHTDASSSPLKIPLQRNSIPSVTRILQQTMP
PEQSFFLERWKERMVLELGEDGFAEYTSNVFLQGKQFHKALESILSPQENLTGGEEHPQCGYIESIQHIL
TEISGVQALESAVQHEALKYVGLLDCVAEYRGKLCVIDWKTSEKPKPLIRNTYDNPLQVVAYMGAVNHDA
HYSFQVQCGLIVVAYKDGSPAHPHFMDEELCSKYWAKWLLRLEEYTEKQKNLSAPEPA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 38.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_083260
Locus ID 74528
UniProt ID Q9CXC3
Refseq Size 2836
Cytogenetics 2 G1
Refseq ORF 1014
Synonyms 8430406I07Rik; AI426476
Summary Metal-dependent single-stranded DNA (ssDNA) exonuclease involved in mitochondrial genome maintenance. Has preference for 5'-3' exonuclease activity but is also capable of endoduclease activity on linear substrates. Necessary for maintenance of proper 7S DNA levels. Probably involved in mitochondrial DNA (mtDNA) repair, possibly via the processing of displaced DNA containing Okazaki fragments during RNA-primed DNA synthesis on the lagging strand or via processing of DNA flaps during long-patch base excision repair (By similarity). Specifically binds 5-hydroxymethylcytosine (5hmC)-containing DNA in stem cells.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...