Pex16 (NM_145122) Mouse Recombinant Protein

CAT#: TP504996

Purified recombinant protein of Mouse peroxisomal biogenesis factor 16 (Pex16), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204996 protein sequence
Red=Cloning site Green=Tags(s)

MEKLRLLSLRYQEYVTRHPAATAQLETAVRGLSYLLAGRFSDSHELSELVYSASNLLVLLNDGILRKELR
KKLPVSLSQQKLLTWLSVLECVEVFMEMGAAKVWGEVGRWLVIALIQLAKAVLRMLLLIWFKAGIQTSPP
IVPLDRETQAQPLDGDHNPGSQEPSYVGKRSHRVVRTLQNSPSLHSRYWGAPQQREIRQKQQQEELSTPP
TPLGLQETIAESLYIARPLLHLLSLGLWGQRSWTPWLLSGVVDMTSLSLLSDRKNLTQRERLELRRRTIL
LLYYLLRSPFYDRFSEAKILFLLQLLTDHIPGVGLVARPLMDYLPSWQKIYFYSWG

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 38.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_660104
Locus ID 18633
UniProt ID Q91XC9
Refseq Size 1470
Cytogenetics 2 E1
Refseq ORF 1011
Summary Required for peroxisome membrane biogenesis. May play a role in early stages of peroxisome assembly. Can recruit other peroxisomal proteins, such as PEX3 and PMP34, to de novo peroxisomes derived from the endoplasmic reticulum (ER). May function as receptor for PEX3 (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...