Xrcc4 (NM_028012) Mouse Recombinant Protein

CAT#: TP504755

Purified recombinant protein of Mouse X-ray repair complementing defective repair in Chinese hamster cells 4 (Xrcc4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204755 protein sequence
Red=Cloning site Green=Tags(s)

MERKVSRIYLASEPNVPYFLQVSWERAIGSGFVITLTDGHSAWTATVSELEISQEADDMAMEKGKYIDEL
RKALVPGSGAAGTYKFLFSKESQHFSLEKELKDVSFRLGSFNLDKVSNSAEVIRELICYCLDTITEKQAK
NEHLQKENERLLRDWNDVQGRFEKCVSAKEALEADLYQRFILVLNEKKTKIRSLHKLLNEVQQLEESTKP
ERENPCSDKTPEEHGLYDGSTDEESGAPVQAAETLHKDDSIFSSPDVTDIAPSRKRRHRMQKNLGTEPKM
APQELPLQEKERLASSLPQTLKEESTSAENMSLETLRNSSPEDLFD

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 37.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_082288
Locus ID 108138
UniProt ID Q924T3
Refseq Size 1557
Cytogenetics 13 C3
Refseq ORF 981
Synonyms 2310057B22Rik; AW413319; AW545101
Summary Involved in DNA nonhomologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination. Binds to DNA and to DNA ligase IV (LIG4). The LIG4-XRCC4 complex is responsible for the NHEJ ligation step, and XRCC4 enhances the joining activity of LIG4. Binding of the LIG4-XRCC4 complex to DNA ends is dependent on the assembly of the DNA-dependent protein kinase complex DNA-PK to these DNA ends (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...