Pycr2 (NM_133705) Mouse Recombinant Protein
CAT#: TP504629
Purified recombinant protein of Mouse pyrroline-5-carboxylate reductase family, member 2 (Pycr2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR204629 protein sequence
Red=Cloning site Green=Tags(s) MSVGFIGAGQLACALARGFTAAGVLSAHKIIASSPDMDLPTVSALRRMGVNLTRSNKDTVRHSDVLFLAV KPHIIPFILDEIGADVQERHIVVSCAAGVTISSVEKKLMAFQPAPKVIRCMTNTPVVVREGATVYATGTH ALVEDGKLLEQLMSSVGFCTEVEEDLIDAITGLSGSGPAYAFMALDALADGGVKMGVPRRLAVRLGAQAL LGAAKMLLDSEDHPGQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRELQSMADQEKVSPA ALKKTLLDRVKLESPTVSTLAPPSSGKLLTRNPAQGSKKE myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 33.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_598466 |
Locus ID | 69051 |
UniProt ID | Q922Q4 |
Refseq Size | 1615 |
Cytogenetics | 1 H4 |
Refseq ORF | 963 |
Synonyms | 1810018M05Rik; P5cr2 |
Summary | Housekeeping enzyme that catalyzes the last step in proline biosynthesis. In some cell types, such as erythrocytes, its primary function may be the generation of NADP(+). Can utilize both NAD and NADP. Has higher affinity for NADP, but higher catalytic efficiency with NADH (By similarity). Involved in cellular response to oxidative stress (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |