Ciapin1 (NM_134141) Mouse Recombinant Protein
CAT#: TP504371
Purified recombinant protein of Mouse cytokine induced apoptosis inhibitor 1 (Ciapin1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR204371 protein sequence
Red=Cloning site Green=Tags(s) MEEFGISPGQLVAVFWDKSSPEEALKKLVARLQELTGSEGQVFMENVTQLLQSSHKESSFDVILSGVVPG STSLHSAEVLAEMARILRPGGCLFLKEPVETAEVNNDKMKTASKLCSALTLSGLVEIKELQREALSPEEV QSVQEHLGYHSDSLRSVRVTGKKPNFEVGSSSQLKLPNKKSSSVKPVVDPAAAKLWTLSANDMEDDSVDL IDSDELLDPEDLKRPDPASLKAPSCGEGKKRKACKNCTCGLAEELEREQSKAQSSQPKSACGNCYLGDAF RCANCPYLGMPAFKPGEQVLLSNSNLQDA myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 33.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_598902 |
Locus ID | 109006 |
UniProt ID | Q8WTY4 |
Refseq Size | 4327 |
Cytogenetics | 8 C5 |
Refseq ORF | 930 |
Synonyms | 2810413N20Rik; AA617265; anamorsin; AU021794 |
Summary | Component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery required for the maturation of extramitochondrial Fe-S proteins. Part of an electron transfer chain functioning in an early step of cytosolic Fe-S biogenesis, facilitating the de novo assembly of a [4Fe-4S] cluster on the scaffold complex NUBP1-NUBP2. Electrons are transferred to CIAPIN1 from NADPH via the FAD- and FMN-containing protein NDOR1. NDOR1-CIAPIN1 are also required for the assembly of the diferric tyrosyl radical cofactor of ribonucleotide reductase (RNR), probably by providing electrons for reduction during radical cofactor maturation in the catalytic small subunit (By similarity). Has anti-apoptotic effects in the cell. Involved in negative control of cell death upon cytokine withdrawal. Promotes development of hematopoietic cells (PubMed:14970183).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Ciapin1产品