Ciapin1 (NM_134141) Mouse Recombinant Protein

CAT#: TP504371

Purified recombinant protein of Mouse cytokine induced apoptosis inhibitor 1 (Ciapin1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204371 protein sequence
Red=Cloning site Green=Tags(s)

MEEFGISPGQLVAVFWDKSSPEEALKKLVARLQELTGSEGQVFMENVTQLLQSSHKESSFDVILSGVVPG
STSLHSAEVLAEMARILRPGGCLFLKEPVETAEVNNDKMKTASKLCSALTLSGLVEIKELQREALSPEEV
QSVQEHLGYHSDSLRSVRVTGKKPNFEVGSSSQLKLPNKKSSSVKPVVDPAAAKLWTLSANDMEDDSVDL
IDSDELLDPEDLKRPDPASLKAPSCGEGKKRKACKNCTCGLAEELEREQSKAQSSQPKSACGNCYLGDAF
RCANCPYLGMPAFKPGEQVLLSNSNLQDA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 33.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_598902
Locus ID 109006
UniProt ID Q8WTY4
Refseq Size 4327
Cytogenetics 8 C5
Refseq ORF 930
Synonyms 2810413N20Rik; AA617265; anamorsin; AU021794
Summary Component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery required for the maturation of extramitochondrial Fe-S proteins. Part of an electron transfer chain functioning in an early step of cytosolic Fe-S biogenesis, facilitating the de novo assembly of a [4Fe-4S] cluster on the scaffold complex NUBP1-NUBP2. Electrons are transferred to CIAPIN1 from NADPH via the FAD- and FMN-containing protein NDOR1. NDOR1-CIAPIN1 are also required for the assembly of the diferric tyrosyl radical cofactor of ribonucleotide reductase (RNR), probably by providing electrons for reduction during radical cofactor maturation in the catalytic small subunit (By similarity). Has anti-apoptotic effects in the cell. Involved in negative control of cell death upon cytokine withdrawal. Promotes development of hematopoietic cells (PubMed:14970183).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...