Hsd17b11 (NM_053262) Mouse Recombinant Protein

CAT#: TP504133

Purified recombinant protein of Mouse hydroxysteroid (17-beta) dehydrogenase 11 (Hsd17b11), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CN¥ 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (3)
Hsd17b11 Antibody - middle region
    • 100 ul

CN¥ 5,250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CN¥ 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CN¥ 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204133 protein sequence
Red=Cloning site Green=Tags(s)

MKYLLDLILLLPLLIVFSIESLVKLFIPKKKKSVAGEIVLITGAGHGIGRLTAYEFAKLNTKLVLWDINK
NGIEETAAKCRKLGAQAHPFVVDCSQREEIYSAAKKVKEEVGDVSILVNNAGVVYTADLFATQDPQIEKT
FEVNVLAHFWTTKAFLPVMMKNNHGHIVTVASAAGHTVVPFLLAYCSSKFAAVGFHRALTDELAALGRTG
VRTSCLCPNFINTGFIKNPSTNLGPTLEPEEVVEHLMHGILTEKQMIFVPSSIALLTVLERIVPERFLQV
LKHRINVKFDAVVGYKDK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 32.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_444492
Locus ID 114664
UniProt ID Q9EQ06
Refseq Size 1699
Cytogenetics 5 E5
Refseq ORF 894
Synonyms Dhrs8; Pan1b; retSDR2; SDR2
Summary Can convert androstan-3-alpha,17-beta-diol (3-alpha-diol) to androsterone in vitro, suggesting that it may participate in androgen metabolism during steroidogenesis. May act by metabolizing compounds that stimulate steroid synthesis and/or by generating metabolites that inhibit it. Has no activity toward DHEA (dehydroepiandrosterone), or A-dione (4-androste-3,17-dione), and only a slight activity toward testosterone to A-dione.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...