Gulp1 (NM_028450) Mouse Recombinant Protein

CAT#: TP503995

Purified recombinant protein of Mouse GULP, engulfment adaptor PTB domain containing 1 (Gulp1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203995 protein sequence
Red=Cloning site Green=Tags(s)

MNRAFSRKKDKTWMHTPEALSKHYIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKV
ELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCFVFDSEKCAEEITLT
IGQAFDLAYRKFLESGGKDVETRKQIAGMQKRIQDLETENMELKNKVQDLESRLRTTQVSTSPAHGVTVM
SPSTDIFDMIPFSPISHQSPTSARNGTQLPPIPSRSAETKRDLFGAEPFDPFNCGSGDFPPDIQSKLDEM
QEGFKMGLTLEGTVFCLDPLDSRC

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 34.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_082726
Locus ID 70676
UniProt ID Q8K2A1
Refseq Size 2976
Cytogenetics 1 C1.1
Refseq ORF 915
Synonyms 3110030A04Rik; 5730529O06Rik; CED-6; Ced6; GULP; Gulp-2
Summary Modulates cellular glycosphingolipid and cholesterol transport. May play a role in the internalization of various LRP1 ligands, such as PSAP (By similarity). May function as an adapter protein. Required for efficient phagocytosis of apoptotic cells. Increases cellular levels of GTP-bound ARF6.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...