Bpifa1 (NM_011126) Mouse Recombinant Protein
CAT#: TP503753
Purified recombinant protein of Mouse BPI fold containing family A, member 1 (Bpifa1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203753 protein sequence
Red=Cloning site Green=Tags(s) MFLVGSLVVLCGLLAHSTAQLAGLPLPLGQGPPLPLNQGPPLPLNQGQLLPLAQGLPLAVSPALPSNPTD LLAGKFTDALSGGLLSGGLLGILENIPLLDVIKSGGGNSNGLVGGLLGKLTSSVPLLNNILDIKITDPQL LELGLVQSPDGHRLYVTIPLGLTLNVNMPVVGSLLQLAVKLNITAEVLAVKDNQGRIHLVLGDCTHSPGS LKISLLNGVTPVQSFLDNLTGILTKVLPELIQGKVCPLVNGILSGLDVTLVHNIAELLIHGLQFVIKV myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 28.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_035256 |
Locus ID | 18843 |
UniProt ID | P97361 |
Refseq Size | 1109 |
Cytogenetics | 2 H1 |
Refseq ORF | 837 |
Synonyms | LUNX; NASG; Plunc; SPLUNC1; SPURT |
Summary | Lipid-binding protein which shows high specificity for the surfactant phospholipid dipalmitoylphosphatidylcholine (DPPC) (By similarity). Plays a role in the innate immune responses of the upper airways (PubMed:23499554). Reduces the surface tension in secretions from airway epithelia and inhibits the formation of biofilm by pathogenic Gram-negative bacteria, such as P.aeruginosa and K.pneumoniae (PubMed:23499554). Negatively regulates proteolytic cleavage of SCNN1G, an event that is required for activation of the epithelial sodium channel (ENaC), and thereby contributes to airway surface liquid homeostasis and proper clearance of mucus (By similarity). Plays a role in the airway inflammatory response after exposure to irritants (By similarity). May attract macrophages and neutrophils (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |