Cops7a (NM_012003) Mouse Recombinant Protein
CAT#: TP503690
Purified recombinant protein of Mouse COP9 signalosome subunit 7A (Cops7a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203690 protein sequence
Red=Cloning site Green=Tags(s) MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVF AYGTYADYLAEARNLPPLTDAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADV LRGSLDQRNQRLEVDYSIGRDIQRQDLSAIAQTLQEWCVGCEVVLSGIEEQVSRANQHKEQQLGLKQQIE SEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPASGTNQRQPSKKASKGKGLRGSAKIWSKSN myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 30.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036133 |
Locus ID | 26894 |
UniProt ID | Q9CZ04 |
Refseq Size | 1775 |
Cytogenetics | 6 59.17 cM |
Refseq ORF | 828 |
Synonyms | D6Ertd35e; SGN7a |
Summary | Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, JUN, I-kappa-B-alpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |