Zfand1 (NM_025512) Mouse Recombinant Protein

CAT#: TP503553

Purified recombinant protein of Mouse zinc finger, AN1-type domain 1 (Zfand1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203553 representing NM_025512
Red=Cloning site Green=Tags(s)

MAELDIGQHCQVQHCRQRDFLPFVCDGCSGIFCLEHRSKDSHGCSEVNVVKERPKTDEHKSYSCSFKGCT
DVELVAVICPYCEKNFCLRHRHQSDHDCEKLEVAKPRMAATQKLVRDIVDAKTGGAASKGRKGAKSSGTA
AKVALMKLKMHADGDKSLPQTERTYFQVYLPKGSKEKSKAMFFCLRWSIGKVVDFAASLANLRNENNKLT
AKKLRLCHVPSGEALPLDHTLERWITKEECPLYNGGNVILEYLNDEEQFLKNVDSYLE

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 30.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_079788
Locus ID 66361
UniProt ID Q8BFR6
Refseq Size 1646
Cytogenetics 3 A1
Refseq ORF 804
Synonyms 2310008M20Rik; AW048890
Summary Plays a role in the regulation of cytoplasmic stress granules (SGs) turnover. SGs are dynamic and transient cytoplasmic ribonucleoprotein assemblies important for cellular protein homeostasis when protein production is suspended after acute exogenous stress. Associates with SGs and is involved in the efficient and specific arsenite-induced clearance process of SGs through the recruitment of the ubiquitin-selective ATPase VCP and the 26S proteasome. This process requires both complexes for efficient degradation of damaged ubiquitinated SG proteins during recovery from arsenite stress, and hence avoiding aberrant cytoplasmic SGs degradation via autophagy.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...