Gjb4 (NM_008127) Mouse Recombinant Protein

CAT#: TP503534

Purified recombinant protein of Mouse gap junction protein, beta 4 (Gjb4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203534 protein sequence
Red=Cloning site Green=Tags(s)

MNWGFLQGILSGVNKYSTALGRIWLSVVFIFRVLVYVVAAEEVWDDDQKDFICNTKQPGCPNVCYDEFFP
VSHVRLWALQLILVTCPSLLVVMHVAYREERERKHRLKHGPNAPALYSNLSKKRGGLWWTYLLSLIFKAA
VDSGFLYIFHCIYKDYDMPRVVACSVTPCPHTVDCYIARPTEKKVFTYFMVVTAAICILLNLSEVVYLVG
KRCMEVFRPRRRKASRRHQLPDTCPPYVISKGGHPQDESVILTKAGMATVDAGVYP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 30.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_032153
Locus ID 14621
UniProt ID Q02738
Refseq Size 1445
Cytogenetics 4 61.51 cM
Refseq ORF 801
Synonyms Cnx30.3; Cx30.3; Gjb-4
Summary Structural component of gap junctions (PubMed:15692151). Gap junctions are dodecameric channels that connect the cytoplasm of adjoining cells. They are formed by the docking of two hexameric hemichannels, one from each cell membrane (By similarity). Small molecules and ions diffuse from one cell to a neighboring cell via the central pore (PubMed:15692151).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...