Uros (NM_009479) Mouse Recombinant Protein
CAT#: TP503514
Purified recombinant protein of Mouse uroporphyrinogen III synthase (Uros), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203514 protein sequence
Red=Cloning site Green=Tags(s) MKVLLLKDAKEDDSGLDPYIQELRLCGLEATLIPVLSFEFMSLPSLSEKLSHPEGFGGLIFTSPRAVEAV KLCLEKDNKTEAWEKSLKDRWNAKSVYVVGSATASLVNKIGLDAEGAGSGNAEKLAEYICSKPSSELPLL FPCGTIKGDTLPKMLKDKGIPMESMHVYQTVPHPGIQGSLKSYYEDQGIPASITFFSPSGLKYSLEYIQA LSGSSFDQIKFIAIGPSTTRAMAAKGLPVSCTAESPTPQALAAGIRNVLKPNHCC myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 28.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_033505 |
Locus ID | 22276 |
UniProt ID | P51163 |
Refseq Size | 1802 |
Cytogenetics | 7 77.26 cM |
Refseq ORF | 798 |
Synonyms | AI415298; Ur; UROIIIS; Uros3 |
Summary | The protein encoded by this gene is the fourth enzyme in the heme biosynthesis pathway. It converts hydroxymethylbilane to uroporphyrinogen III, a cyclic tetrapyrrole. This enzyme is defective in the autosomal recessive disorder congenital erythropoietic porphyria. Alternate promoter usage controls cell type-specific expression, including erythroid cell-specific expression. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2014] |
Documents
FAQs |
SDS |