Reep4 (NM_180588) Mouse Recombinant Protein

CAT#: TP503308

Purified recombinant protein of Mouse receptor accessory protein 4 (Reep4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203308 protein sequence
Red=Cloning site Green=Tags(s)

MVSWMICRLVVLIFGMLYPAYASYKAVKSKNIREYVRWMMYWIVFAIFMAAETFTDIFISWFPFYYEFKM
AFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDACIVQAKERSYETMLSFGKRSLNIAASAAVQAATKS
QGALAGRLRSFSMQDLRSIPDTPVPTYQDPLYLEDQVPRRRPPIGYRPGGLQGSDTEDECWSDNEIVPQP
PVRPREKPLGRSQSLRVVKRKPLTREGTSRSLKVRTRKKAMPSDMDS

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-MYC/DDK
Predicted MW 29.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_850919
Locus ID 72549
UniProt ID Q8K072
Refseq Size 1686
Cytogenetics 14 D2
Refseq ORF 774
Synonyms 2700029E10Rik
Summary Microtubule-binding protein required to ensure proper cell division and nuclear envelope reassembly by sequestering the endoplasmic reticulum away from chromosomes during mitosis. Probably acts by clearing the endoplasmic reticulum membrane from metaphase chromosomes (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...