Kctd6 (NM_027782) Mouse Recombinant Protein
CAT#: TP502907
Purified recombinant protein of Mouse potassium channel tetramerisation domain containing 6 (Kctd6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202907 protein sequence
Red=Cloning site Green=Tags(s) MDNGDWGYMMSDPVTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTARDPQGNYFIDRDGPLFRYVLN FLRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPRPLYPMDTFEEVVELSSTRKLSKYSNPVAVII TQLTITTKVHSLLEGISNYFTKWNKHMMDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRV HHMSERANENTVEHNWTFCRLARKTDD myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 27.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_082058 |
Locus ID | 71393 |
UniProt ID | Q8BNL5 |
Refseq Size | 1667 |
Cytogenetics | 14 A1 |
Refseq ORF | 714 |
Synonyms | 5430433B02Rik; AU044285 |
Summary | Probable substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex mediating the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes the ubiquitination of HDAC1; the function seems to depend on KCTD11:KCTD6 oligomerization. Can function as antagonist of the Hedgehog pathway by affecting the nuclear transfer of transcription factor GLI1; the function probably occurs via HDAC1 down-regulation, keeping GLI1 acetylated and inactive. Inhibits cell growth and tumorigenicity of medulloblastoma (MDB). Involved in regulating protein levels of ANK1 isoform Mu7 probably implicating CUL3-dependent proteasomal degradation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |