Otub2 (NM_026580) Mouse Recombinant Protein
CAT#: TP502832
Purified recombinant protein of Mouse OTU domain, ubiquitin aldehyde binding 2 (Otub2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202832 representing NM_026580
Red=Cloning site Green=Tags(s) MSETSFNLISEKCDILSILRDHPENRIYQRKIQELSKRFTSIRKTKGDGNCFYRALGYSYLESLLGKSRE ILKFKERVLQTPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDSSVSSLLKVFNDQSSSDRIVQFLRLLTS AFIRNRADFFRHFIDEEMDIKDFCTHEVEPMAMECDHVQITALSQALNIALQVEYVDEMDTALNHHVFPE AAIPSVYLLYKTSHYNILYAAEKH myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 27.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_080856 |
Locus ID | 68149 |
UniProt ID | Q9CQX0 |
Refseq Size | 2813 |
Cytogenetics | 12 E |
Refseq ORF | 702 |
Synonyms | 2010015L18Rik; 4930586I02Rik; AI413508; AW557219; OTB2; OTU2 |
Summary | Hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation. Mediates deubiquitination of 'Lys-11'-,'Lys-48'- and 'Lys-63'-linked polyubiquitin chains, with a preference for 'Lys-63'-linked polyubiquitin chains (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |