Cd79b (NM_008339) Mouse Recombinant Protein
CAT#: TP502725
Purified recombinant protein of Mouse CD79B antigen (Cd79b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 1 publication. |
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202725 protein sequence
Red=Cloning site Green=Tags(s) MATLVLSSMPCHWLLFLLLLFSGEPVPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHS GALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELL VLGFSTLDQLKRRNTLKDGIILIQTLLIILFIIVPIFLLLDKDDGKAGMEEDHTYEGLNIDQTATYEDIV TLRTGEVKWSVGEHPGQE myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 25.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_032365 |
Locus ID | 15985 |
UniProt ID | P15530 |
Refseq Size | 1232 |
Cytogenetics | 11 68.89 cM |
Refseq ORF | 687 |
Synonyms | B29; Ig; Ig-be; Ig-beta; Igb; Igbe; Igbeta |
Summary | The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Sep 2015] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Anti-CD79 Antibody Induces B cell Anergy That Protects Against Autoimmunity
,null,
Journal of immunology (Baltimore, Md. : 1950)
,PubMed ID 24442438
[Cd79b]
|
Documents
FAQs |
SDS |