Chchd3 (NM_025336) Mouse Recombinant Protein

CAT#: TP502692

Purified recombinant protein of Mouse coiled-coil-helix-coiled-coil-helix domain containing 3 (Chchd3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR202692 protein sequence
Red=Cloning site Green=Tags(s)

MGGTASTRRVTFEADENENITVVKGIRLSENVIDRMKESSPSGSKSQRYSSVYGASVSDEDLKRRVAEEL
ALEQAKKESEHQRRLKQARDLERERAAANEQLTRAVLRERISSEEERMKAKHLARQLEEKDRVMRKQDAF
YKEQLARLEERSSEFYKVTTEEYQKAAEEVEAKFKRYEYHPVCADLQTKILQCYRQNTQQTLSCSALASQ
YMHCVNHAKQSMLEKGG

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 26.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_079612
Locus ID 66075
UniProt ID Q9CRB9
Refseq Size 1432
Cytogenetics 6 A3.3
Refseq ORF 684
Synonyms 0610041L09Rik; 1700039J09Rik; AW558177
Summary Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Has also been shown to function as a transcription factor which binds to the BAG1 promoter and represses BAG1 transcription. Plays an important role in the maintenance of the MICOS complex stability and the mitochondrial cristae morphology.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...