Mif4gd (NM_027162) Mouse Recombinant Protein
CAT#: TP502548
Purified recombinant protein of Mouse MIF4G domain containing (Mif4gd), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202548 protein sequence
Red=Cloning site Green=Tags(s) MSEASRDDYKIQSFDAETQQLLKTALKDPSAVDLERVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQA GQSVFRRGLLNRLQKEYDAREQLRACSLQGWVCYVTFICNIFDYLRVNNMPMMALVNPVYDCLFQLAQPE SLSREEEVDCLVLQLHRVGEQLEKMNGQRMDELFILIRDGFLLPTDLSSLARLLLLEMIEFRAAGWKTTP AAHKYYYSEVSD myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 25.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_081438 |
Locus ID | 69674 |
UniProt ID | Q3UBZ5 |
Refseq Size | 1671 |
Cytogenetics | 11 E2 |
Refseq ORF | 669 |
Synonyms | 1110014L05Rik; 2310075G12Rik |
Summary | Functions in replication-dependent translation of histone mRNAs which differ from other eukaryotic mRNAs in that they do not end with a poly-A tail but a stem-loop. May participate in circularizing those mRNAs specifically enhancing their translation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |