Rab17 (NM_008998) Mouse Recombinant Protein

CAT#: TP502342

Purified recombinant protein of Mouse RAB17, member RAS oncogene family (Rab17), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CN¥ 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (3)
Goat Polyclonal Antibody against Rab17
    • 100 ug

CN¥ 5,371.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CN¥ 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CN¥ 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR202342 protein sequence
Red=Cloning site Green=Tags(s)

MAQAAGLPQASTASGQPYLSKLVLLGSSSVGKTSLALRYMKQDFSNVLPTVGCAFFTKVLDLGSSSLKLE
IWDTAGQEKYQSVCHLYFRGANAALLVYDITRKDSFHKAQQWLEDLEKEFQPGEVVVMLVGNKTDLGEER
EVTFQEGKEFAESKSLLFMETSAKLNYQVSEIFNTVAQELLQRAGDTGSSRPQEGEAVALNQEPPIRQRQ
CCAR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 23.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_033024
Locus ID 19329
UniProt ID P35292
Refseq Size 1825
Cytogenetics 1 45.84 cM
Refseq ORF 642
Synonyms AW413472
Summary The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab is involved in transcytosis, the directed movement of endocytosed material through the cell and its exocytosis from the plasma membrane at the opposite side. Mainly observed in epithelial cells, transcytosis mediates for instance, the transcellular transport of immunoglobulins from the basolateral surface to the apical surface. Most probably controls membrane trafficking through apical recycling endosomes in a post-endocytic step of transcytosis. Required for melanosome transport and release from melanocytes, it also regulates dendrite and dendritic spine development. May also play a role in cell migration.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...