Emc9 (NM_033146) Mouse Recombinant Protein
CAT#: TP502173
Purified recombinant protein of Mouse ER membrane protein complex subunit 9 (Emc9), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
货期*
4周
规格
Product images
经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202173 representing NM_033146
Red=Cloning site Green=Tags(s) MGEVEISARAYGKMCLHASRYPHAAVNGLLLAPATGSGECLCLTDCVPLFHSHLALSVMLEVALNQVDVW GAQAGLVVAGYYHANAVLDDQSPGPLALKIAGRIAEFFPRAVLIMLDNKKLVTRPRVPPVIVLENQGLQW VPKDKNLVMWRDWEESRQMVGALLEGRAHQHLVDFDCHLDDIRQDWTNQRLNTQITQWSGSTDGNA myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 22.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_149158 |
Locus ID | 85308 |
UniProt ID | Q9DB76, Q793L1 |
Refseq Size | 805 |
Cytogenetics | 14 C3 |
Refseq ORF | 618 |
Synonyms | 1500005A01Rik; Cgi112; Fam158a |
Summary | Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins. Preferentially accommodates proteins with transmembrane domains that are weakly hydrophobic or contain destabilizing features such as charged and aromatic residues. Involved in the cotranslational insertion of multi-pass membrane proteins in which stop-transfer membrane-anchor sequences become ER membrane spanning helices. It is also required for the post-translational insertion of tail-anchored/TA proteins in endoplasmic reticulum membranes. By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology, with translocated N-terminus in the lumen of the ER, controls the topology of multi-pass membrane proteins like the G protein-coupled receptors. By regulating the insertion of various proteins in membranes, it is indirectly involved in many cellular processes.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...