Ndufb9 (NM_023172) Mouse Recombinant Protein

CAT#: TP501589

Purified recombinant protein of Mouse NADH:ubiquinone oxidoreductase subunit B9 (Ndufb9), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CN¥ 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CN¥ 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR201589 protein sequence
Red=Cloning site Green=Tags(s)

MAFCAPPAYLTHQQKVLRLYKRALRHLESWCIHRDKYRYFACLMRARFEEHKNEKDMMRATQLLREAEEE
FWQNQHPQPYIFPDSPGGTSFERYECYKVPEWCLDYWHPSEKAMYPDYFSKREQWKKLRMESWDREVKQL
QEETSPDGIMTEALPPARREGDLPPLWWHIVTRPRERPT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 22 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_075661
Locus ID 66218
UniProt ID Q9CQJ8
Refseq Size 651
Cytogenetics 15 D1
Refseq ORF 537
Synonyms 1190008J14Rik
Summary Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...