Sip1 (BC053424) Mouse Recombinant Protein

CAT#: TP501583

Purified recombinant protein of Mouse survivor of motor neuron protein interacting protein 1 (cDNA clone MGC:59266 IMAGE:6336522), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
Rabbit Polyclonal Anti-Sip1 Antibody
    • 50 ug

CNY 4,628.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR201583 protein sequence
Red=Cloning site Green=Tags(s)

MYVLLNCRIEAAQCPDVVVAQIDPKKLKRKQSVNISVQRFSPLSSRWEHGSIQAGLAQEELRVLHLHPKA
ASGRLTPRQLGFPDASLRLKVTLQHFSGNNNKWHIFQLFDRVYTSIEITGNHNSWTVMWQCQNLKMKKAG
KNFVWVKGYVLKGPLDRLQRKALGSIMYKLVFLLCLVL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 20.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 66603
UniProt ID Q9CQQ4
Refseq Size 2064
Cytogenetics 12 C1
Refseq ORF 534
Synonyms Gemin2
Summary This gene encodes one of the proteins found in the survival of motor neuron (SMN) complex, which consists of the SMN protein and several gemin proteins. The SMN complex is localized to a subnuclear compartment called gems (gemini of coiled bodies) and is required for assembly of spliceosomal small nuclear ribonucleoproteins (snRNP) and for pre-mRNA splicing. This protein interacts directly with the SMN protein and it is required for formation of the SMN complex. Disruption of this gene in mouse resulted in impaired snRNP assembly, and motor neuron degeneration. [provided by RefSeq, Sep 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...