Reep6 (BC029741) Mouse Recombinant Protein

CAT#: TP501510

Purified recombinant protein of Mouse receptor accessory protein 6 (cDNA clone MGC:25862 IMAGE:4195889), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR201510 protein sequence
Red=Cloning site Green=Tags(s)

MDGLRQRFERFLEQKNVATEALGALEARTGVEKRYLAAGALALLGLYLLFGYGASLLCNVIGFVYPAYAS
VKAIESPSKEDDTVWLTYWVVYALFGLVEFFSDLLLFWFPFYYAGKCAFLLFCMTPGPWNGALLLYHRVI
RPLFLKHHMALDSAASQLSGRALDLAAGITRDAK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 19.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 70335
UniProt ID Q9JM62
Refseq Size 1949
Cytogenetics 10 C1
Refseq ORF 522
Synonyms 0610011M24Rik; Dp1l1
Summary Required for correct function and survival of retinal photoreceptors (PubMed:24098485, PubMed:24691551, PubMed:28475715). Required for retinal development (PubMed:28369466). In rod photoreceptors, facilitates stability and/or trafficking of guanylate cyclases and is required to maintain endoplasmic reticulum and mitochondrial homeostasis (PubMed:28475715). May play a role in clathrin-coated intracellular vesicle trafficking of proteins from the endoplasmic reticulum to the retinal rod plasma membrane (PubMed:24098485, PubMed:28369466).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...