Tspo (NM_009775) Mouse Recombinant Protein
CAT#: TP501408
Purified recombinant protein of Mouse translocator protein (Tspo), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201408 protein sequence
Red=Cloning site Green=Tags(s) MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYAGLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKE LGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPY LAWLAFATVLNYYVWRDNSGRRGGSRLAE myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 18.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_033905 |
Locus ID | 12257 |
UniProt ID | P50637 |
Refseq Size | 871 |
Cytogenetics | 15 39.4 cM |
Refseq ORF | 510 |
Synonyms | Bzrp; IBP; PBR; Tspo1 |
Summary | Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme (By similarity). Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides. Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism (PubMed:9832438, PubMed:24814875), but its precise physiological role is controversial. According to some reports, it is not required for steroid hormone biosynthesis (PubMed:24174323, PubMed:24936060).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |