Polr1d (NM_181730) Mouse Recombinant Protein

CAT#: TP500671

Purified recombinant protein of Mouse polymerase (RNA) I polypeptide D (Polr1d), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR200671 protein sequence
Red=Cloning site Green=Tags(s)

MEDDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLAGTNKRFLINTIKNTLPSHKEQDHEQKEGSK
EPGKSQDQKEASGKKYRSHSYKRSLHSSRGSAGCSPPRKRTSRTSGDKCDPRPSRR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 14.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_859419
Locus ID 20018
UniProt ID Q9D1M1
Refseq Size 1147
Cytogenetics 5 G3
Refseq ORF 381
Synonyms 16kD; 1110003G10Rik; AC19; mRP; RPA16; Rpo; Rpo1-3
Summary This gene encodes an RNA polymerase subunit that is a component of both the RNA polymerase I and RNA polymerase III complexes. RNA polymerase I is associated with transcription of pre-ribosomal RNAs, while RNA polymerase III is associated with transcription of small RNAs. Pseudogenes of this gene have been defined on chromosomes 4 and 6. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...